DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and fh

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_002935862.2 Gene:fh XenbaseID:XB-GENE-944116 Length:497 Species:Xenopus tropicalis

Alignment Length:476 Identity:270/477 (57%)
Similarity:356/477 (75%) Gaps:4/477 (1%)


  Fly    10 SLMYKLARLIVPDTRVEYDSMGAVHIPLDRMFGPQTMRSLMKFPIGGVEERMPRPLIKALGIVKK 74
            ||..|..|: ....|:|.|:.|.:.:|.|:.:|.||:||.|.|.||||.||||.|:|:|.||:|:
 Frog    25 SLTVKQGRM-ASSYRIESDTFGELQVPNDKYYGAQTVRSTMNFKIGGVTERMPVPVIRAFGILKR 88

  Fly    75 SAAETNKIHCLEEHLCDAISKACDDVISGKLYDEEHFPLVIWQDGSGEHTNMNVNEVICNRAIEI 139
            :|||.|:.:.|:.::.:.|.||.|:|.||||  ::|||||:||.|||..|||||||||.|||||:
 Frog    89 AAAEVNQDYGLDPNIANFIIKAADEVSSGKL--DDHFPLVVWQTGSGTQTNMNVNEVISNRAIEM 151

  Fly   140 LGGQMGSKEPVDPNEHVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLI 204
            :||::|||:||.||:|||.:|||:|||.||:.||...::.|.|.|.|:...|.|.:||.::.::|
 Frog   152 MGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAVKEVHEVLLPGLQKLHDALEEKSKEFENII 216

  Fly   205 KIGRTHLMDAVPLSLGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCI 269
            ||||||..|||||:|||||.||.||:....:|:..|:.|:|:|..|||:|||.::|:..::.:..
 Frog   217 KIGRTHTQDAVPLTLGQEFGGYVQQIKYSVSRIKAALPRVYELAAGGTAVGTGLNTRIGFAEKVA 281

  Fly   270 KRIAELTFLPFVESPNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLP 334
            .::||||.|||:.:||.|||::|.|.||||.|.|||:|.|:|||||||||||||||.|.|||.||
 Frog   282 AKVAELTGLPFITAPNKFESLAAHDALVELSGALNTLACSLMKIANDIRFLGSGPRSGLGELILP 346

  Fly   335 ENEPGSSIMPGKVNPTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLG 399
            ||||||||||||||||||||::|:.|||||||||:|:|.|:|||:||.|.|:|..|||:||.|||
 Frog   347 ENEPGSSIMPGKVNPTQCEAVTMVAAQVMGNHVAISIGCSNGHFELNVFKPVIIKNVLQSIRLLG 411

  Fly   400 DGMKSFCTNCLEGIEPNRSKIGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLEQEAILD 464
            |...||..||:.|::.|..:|..::.|||||||||:|||||:::|.|||.||..||||::.||..
 Frog   412 DAAVSFTDNCIVGVQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKETAIKL 476

  Fly   465 GIQRED-FREWVQPSKMLGPE 484
            |....| |.:||:|..||||:
 Frog   477 GFLTSDQFDQWVKPEDMLGPK 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 265/462 (57%)
Fumarase_classII 24..480 CDD:176465 262/457 (57%)
fhXP_002935862.2 fumC 34..497 CDD:234779 266/465 (57%)
Fumarase_classII 38..493 CDD:176465 262/457 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022919at2759
OrthoFinder 1 1.000 FOG0001878
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.