DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and Kcmf1

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001121664.1 Gene:Kcmf1 RGDID:1591490 Length:381 Species:Rattus norvegicus

Alignment Length:375 Identity:87/376 (23%)
Similarity:123/376 (33%) Gaps:140/376 (37%)


  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPLLYGE 67
            |..:.|:.|....|:|.|::||.|.:|:||..||:....|..|..:||||......|. .|.||.
  Rat     4 HEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDF-DLYYGG 67

  Fly    68 IPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLS-----------AAEL 121
            ....|.....||||:||.:..|.....|||..:|..::..|:||:||.|.           ||.|
  Rat    68 EAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHL 132

  Fly   122 V-------------AIRHLSKHLLH--------------NHIDHA-------------------- 139
            .             .:||: :.:.|              .|...:                    
  Rat   133 TLEHRAPRDLDESSGVRHV-RRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSSREAM 196

  Fly   140 ---------------------NYLEPDTPPLRRI-----FTRNHMRHHRQSQLQTTPN------- 171
                                 |...|....|:::     ..|.|.:..|| ||:|..|       
  Rat   197 DPIAELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQ-QLETARNASRRTNT 260

  Fly   172 ----SRIFDISVWLSTGRVSSDPQLLSN--------NDPPEEAANSESLALGLSSGGPFEHDDDR 224
                :.|...:...:|....:.||.|.|        |||....|..:|:                
  Rat   261 SSVTTTITQATATANTANTENSPQALHNSQFLLTRLNDPKMSEAERQSM---------------- 309

  Fly   225 YVLLQWIAQQKVQCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRR 274
                              ||:|..|:|||:.||:|.|..||....|.|.|
  Rat   310 ------------------ESERADRSLFVQELLLSTLVREESSSSDEDER 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 19/48 (40%)
zf-Di19 76..130 CDD:283297 22/78 (28%)
Kcmf1NP_001121664.1 ZZ_PCMF_like 7..55 CDD:239078 19/48 (40%)
zf-Di19 76..137 CDD:283297 20/61 (33%)
Di19_C <280..328 CDD:291251 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12268
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.