DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and Kcmf1

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001163560.1 Gene:Kcmf1 FlyBaseID:FBgn0037655 Length:599 Species:Drosophila melanogaster

Alignment Length:515 Identity:105/516 (20%)
Similarity:155/516 (30%) Gaps:214/516 (41%)


  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPLLYGE 67
            |..:.|:.|..:.|.|.|::||.|.:|:||..||:..:.:..|...||||......|:.....||
  Fly     4 HEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGE 68

  Fly    68 I-----PELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAE--LVAIR 125
            :     |:      .||||:|..:..:....:|||..:|..::..||||:||||...|  ||. .
  Fly    69 MLASDQPQ------SFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVT-D 126

  Fly   126 HLSKHLLHNHIDHANYL-----EPDT----PPLRRI--------FTRNHMRHHRQSQLQTTPNSR 173
            ..:.||...|......|     ||..    ..:|||        .||....|...|.        
  Fly   127 DFAGHLTLEHRQGPRELISFLDEPSAIRHGGGVRRIPGRTLGGPRTRRSNMHFSSSS-------- 183

  Fly   174 IFDISVWLSTGRVSSDP--QLLS------NNDPP------------------------------- 199
              .:|....:||.|.||  :|||      ...||                               
  Fly   184 --GLSALSPSGRESVDPIAELLSQLSGVRRGGPPTSQLQQLQMQMQLDRQQVTASRQIDRLPRRA 246

  Fly   200 --------EEAANSE-----------SLALGLSSGG------------------------PFEHD 221
                    ..||.:|           |.|:|..|||                        ...|.
  Fly   247 HPIVSTSNSNAAMAEVISGGAGGSGGSGAVGSGSGGGSGATAPPNLRTTEWPVTASFSTSASNHS 311

  Fly   222 DDRYVLL---------------------------------------------------------- 228
            ..:..|.                                                          
  Fly   312 QTQSSLAANSLNAREAIGTSSSAGSNVLGISVGVGGTANGNGGAGSSGVATGAGGAGQGGGQGGA 376

  Fly   229 ----QWIAQQKVQCHDTD------ESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESD 283
                .::..|.:|...|:      ||.|..|::||:.|::||||.|.|.|...|..:.:.     
  Fly   377 AAGESFLLAQFMQPTFTEAEWAVVESMRADRSMFVQSLMLSMLCTEALDLNASDESLAKS----- 436

  Fly   284 LDQENHSSLVKVMSVMSLPWTGVWQTNQLDGSEGEGEIRAAKKDGVDLDKVQIEEHKRVA 343
             |..|..                 |..|.:.:|.|.:......:..|:::.|.::..:.|
  Fly   437 -DNVNKG-----------------QQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPA 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 18/48 (38%)
zf-Di19 76..130 CDD:283297 20/56 (36%)
Kcmf1NP_001163560.1 ZZ_PCMF_like 7..55 CDD:239078 18/48 (38%)
zf-Di19 76..137 CDD:310299 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C132381959
eggNOG 1 0.900 E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6024
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12268
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2931
54.910

Return to query results.
Submit another query.