DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and kcmf1

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_957246.1 Gene:kcmf1 ZFINID:ZDB-GENE-040426-1383 Length:383 Species:Danio rerio

Alignment Length:359 Identity:85/360 (24%)
Similarity:130/360 (36%) Gaps:106/360 (29%)


  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPLLYGE 67
            |..:.|:.|....|:|.|::||.|.:|:||..||:....|..|...||||......|. .|.||.
Zfish     4 HEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDF-DLYYGG 67

  Fly    68 IPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLS-----------AAEL 121
            ....|.....||||:||.:..|.....|||..:|..::..|:||:||.|.           ||.|
Zfish    68 EAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHL 132

  Fly   122 V-------------AIRHLSKHLLH--------------NHIDHA-------------------- 139
            .             .:||: :.:.|              .|...:                    
Zfish   133 TLEHRAPRDLDESSGVRHV-RRMFHPGRGLGGPRARRTNMHFTSSSTGGLSSSQSSSYSPSNREA 196

  Fly   140 ----------------------NYLEPDTPPLRRI-----FTRNHMRHHRQSQLQTTPNSRIFDI 177
                                  |...|....|:::     ..|...:..|| ||:|..|:.    
Zfish   197 MDPIAELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQQAQAARQ-QLETARNAT---- 256

  Fly   178 SVWLSTGRVSSDPQLLSNNDPPEEAANSESLALGLSSGGPFEHDDDRYVLLQWIAQQKVQCHDTD 242
                   |..|:|..:|.:.||...|.:.:    ::...|......:::|.: :.:.|:...:..
Zfish   257 -------RQRSNPSNISASIPPPSTATNTA----MTESNPLASHSSQFLLTR-LNEPKMSEAERQ 309

  Fly   243 --ESQRLRRTLFVEHLLISMLCCEELQLPDGDRR 274
              ||:|..|:|||:.||:|.|..||....|.|.|
Zfish   310 ALESERADRSLFVQELLLSTLMREESSSSDEDER 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 19/48 (40%)
zf-Di19 76..130 CDD:283297 22/78 (28%)
kcmf1NP_957246.1 ZZ_PCMF_like 7..55 CDD:239078 19/48 (40%)
zf-Di19 76..137 CDD:283297 20/61 (33%)
Di19_C <259..330 CDD:291251 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4626
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12268
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2931
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.