DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and Dyb

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097287.1 Gene:Dyb FlyBaseID:FBgn0033739 Length:816 Species:Drosophila melanogaster

Alignment Length:311 Identity:66/312 (21%)
Similarity:98/312 (31%) Gaps:96/312 (31%)


  Fly     8 CNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLF-----PDSDDLVPLLYGE 67
            |:.|....|.|.|:||.||..|.||..|:.|...:..|:.:|.::.:     |..          
  Fly   234 CSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEYSSYKSPSK---------- 288

  Fly    68 IPELVH-LSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAG-----LSAAELVAIRH 126
              ::.| |...|.|             :....||        |.|....     |:.:.:|....
  Fly   289 --QIGHSLRKSFRC-------------VPEKTVQ--------VLPRFPDQPEKTLNLSHIVPPSP 330

  Fly   127 LSKH--------LLHNHIDHANYLEPDTPPLRRIFTRNHMRHHRQSQLQTTPNSRIFDISVWLST 183
            |..|        |:|.|  |..:  |..|....:|.|:       |.|.:....|..| |...:.
  Fly   331 LPSHNGFSDPSGLVHGH--HGPH--PGLPGQHGLFDRS-------STLDSRATGRSLD-SASGTA 383

  Fly   184 GRVSSDPQLLSNNDPPEEAANSESLALGLSSGGPFEHDDD------------RYVLLQWIAQQKV 236
            |...|.....|.||.........:..|...:..|....|:            |.::.|..::.| 
  Fly   384 GTTMSRVAAASANDEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNSRAQRELIAQLESKNK- 447

  Fly   237 QCHDTDESQRLRRTLFVEHL------LISMLCCEELQLPDGDRRIREGNGE 281
              ....|..||||....|.:      ||:.|           |.:|:..||
  Fly   448 --EIMREIARLRRQQETEQMAPENPALINEL-----------RALRQRKGE 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 16/46 (35%)
zf-Di19 76..130 CDD:283297 9/59 (15%)
DybNP_001097287.1 EF-hand_2 7..131 CDD:286194
EF-hand_3 135..223 CDD:286195
ZZ_dystrophin 232..280 CDD:239074 16/46 (35%)
Ribosomal_L29 436..482 CDD:279204 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12268
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.