DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and CG3526

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_726832.2 Gene:CG3526 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster

Alignment Length:236 Identity:58/237 (24%)
Similarity:100/237 (42%) Gaps:62/237 (26%)


  Fly     2 GHRNICCNGC---QMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPL 63
            ||.|:.|:||   :||.:   |::||.|::|:||..|.::.:....|..:||:|...|.|.|...
  Fly    26 GHCNVRCDGCGNNRMTFY---RYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELH 87

  Fly    64 LYGE-IPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHL 127
            ..|| ||.|  .::.||||.||.:..:.:....|....||::....:||:||.:..::...|.|:
  Fly    88 FAGEPIPIL--CADSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIAHI 150

  Fly   128 SKHLLHNHIDHANYLEPDTPPLRRIFTRNHMRHHRQSQLQTTPNSRIFDISVWLSTGRVSSDPQL 192
            :.||:                    |:.:|                           |.:.||.:
  Fly   151 ANHLM--------------------FSPSH---------------------------RATGDPMI 168

  Fly   193 -LSNNDPPEEAANSESLALGLSSGGPF-----EHDDDRYVL 227
             :|.....|.::..::.|:...||...     |:...|::|
  Fly   169 DISATSQAEGSSLPQNSAVSSGSGAQHTFSSSENSQVRFLL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 17/51 (33%)
zf-Di19 76..130 CDD:283297 15/54 (28%)
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 17/51 (33%)
zf-Di19 99..149 CDD:283297 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131570540
eggNOG 1 0.900 E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12268
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.