DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31835 and ZK652.6

Sequence 1:NP_723881.1 Gene:CG31835 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001023028.2 Gene:ZK652.6 WormBaseID:WBGene00022785 Length:552 Species:Caenorhabditis elegans

Alignment Length:370 Identity:95/371 (26%)
Similarity:147/371 (40%) Gaps:74/371 (20%)


  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICY------DHQ--IETEEHRANHPMQLFPDSDD 59
            |..:.|:||..|.|.|:|::||||.:|:||..|:      |.|  .:...|..:|||||...|.|
 Worm     9 HEGVSCDGCAFTAFAGNRYKCLRCSDYDLCFSCFTTKNYGDQQTIADIPIHDESHPMQLILSSVD 73

  Fly    60 LVPLLYGEIP-------ELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEY-VVCPMCAGL 116
            . .|:|...|       ::|    .||||:|.:..||.::|..||..||..:..| |:||:|.|.
 Worm    74 F-DLVYQGDPTRHYDERKIV----SFTCPYCNITGLTERQFGTHVLSQHPEAPGYSVICPLCIGN 133

  Fly   117 SAAELVAIR---HLSKHLLHNHIDHANYLEPDTPPL-RRIFTRNHM---RHHRQSQLQTTPNSR- 173
            :..|.:..:   :||.|....|:.....|...|.|: .|...|..|   |.:|....:|....| 
 Worm   134 TEMEHIQSKETENLSVHWTEIHLHTMENLFRSTEPITTRPVQRRPMLARRGNRAGVSRTAAQGRP 198

  Fly   174 ----IFDISVWLSTGRVSSDPQLLSNNDPPEEAANSESLALGLSSGGPFEHDDDR-YVLLQWIAQ 233
                |..::|.|..|..||...:.|..|.|.....|           ...|.|.. ..:::.:|.
 Worm   199 LQDEIEMMTVPLLPGIRSSQRLMTSTGDRPTVVVES-----------AVTHQDPNVQQVIRPLAT 252

  Fly   234 QKVQCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESDLDQENHSSLVKVMSV 298
            ..:....:|||.                  :|...|..|   .....|.|.|.:....:..::..
 Worm   253 IPIYPPTSDESG------------------DETPQPAAD---SADESEDDNDIQELDDMQPIVED 296

  Fly   299 MSLPWTGVWQTNQLDGSEGEGEI-------RAAKKDGVDLDKVQI 336
            .:|.....|:|.:...||.:.::       .|..|:.:| ||:.:
 Worm   297 EALKKDEFWKTLKTRISEEDVDLILETMKSTAKVKEDID-DKMPV 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 23/56 (41%)
zf-Di19 76..130 CDD:283297 21/58 (36%)
ZK652.6NP_001023028.2 ZZ_PCMF_like 12..68 CDD:239078 23/56 (41%)
zf-Di19 93..>130 CDD:283297 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131570445
eggNOG 1 0.900 E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12268
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2931
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.