DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31815 and CG4631

Sequence 1:NP_723979.1 Gene:CG31815 FlyBaseID:FBgn0051815 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_609799.1 Gene:CG4631 FlyBaseID:FBgn0032590 Length:796 Species:Drosophila melanogaster

Alignment Length:470 Identity:111/471 (24%)
Similarity:175/471 (37%) Gaps:102/471 (22%)


  Fly     3 MRKICC----------SLTANFPWTSKIVSI-----GQKQPSRSTCLSQEHCLWRQRNQMEIEQL 52
            |...||          :....||...::.|.     |:|  :.|.|:|.|. .|.|||...|:.|
  Fly     1 MNSCCCRSHSDRTNPMACLPQFPRLQRVQSCRPFLEGRK--AASCCVSGER-RWGQRNGCMIQVL 62

  Fly    53 AKLVGFQPDEIDGFLFNLSLRNYSDLLKYKECGWNGCNVPLCYPYVCDRYMAIFDHRGNLRSPIH 117
            ||:|......:..||..|:|:.::.:|.....|||...||...|.:|:.|..|||..||:|..|.
  Fly    63 AKMVNKSSSTVCQFLHQLTLQVFARILYPLMLGWNTLKVPFVIPDICELYYGIFDECGNIRGSIP 127

  Fly   118 ARSLKSLLPLLLDYLNGDSPNDRKDSPIYEAYPDEHQAKCRSNIEQSDLEAMSSSDWISQLLGNP 182
            .|:|..|:.::..:||......:..:          .:.|||  :..||..:.|..:..:....|
  Fly   128 TRTLLILISMIQYFLNLPKRCGQNSA----------CSGCRS--QTDDLRNIHSPGYCGKNAMTP 180

  Fly   183 SESKREKTGKKTEKPQPVMRSELESELESESEMEKKKRKNKTFGRQSVFLNDELALAYAKSYDYA 247
            . |.|..|.|...|...|.........|...:::.             :.:||     :..|.||
  Fly   181 F-SGRGITEKGPSKGSDVWAGLKRLGYERRGDLDS-------------YPSDE-----SIPYGYA 226

  Fly   248 EYLMKTLGRHRFRDSYIGP--VGDLRTTRTHILIRDLIARKGMNINEKNLRKALKKVDLEWKGTT 310
            .        ||.      |  .|..|..|:.|| .....|.|.      :|..:...:|| ....
  Fly   227 P--------HRC------PCQAGSPRIQRSGIL-NPYANRPGA------MRSLVCAEELE-SSML 269

  Fly   311 RADYKREM-------KTAQ-----EISRLYNVIVQTPSDEPIPWRIIGKVRENYPKVPKASKSPR 363
            .:||.:::       |.||     .||.||..:||.....    ::....|...|:|...:::..
  Fly   270 DSDYNQQIPMAPISPKAAQIIHINHISNLYAAVVQNQHTR----QLFADGRPPRPRVRPCTENQN 330

  Fly   364 KYLADQDAMVFHEPFDHKKNWTWQRRQSKRTIRNSNYKFSTTRIKPYISRSMKQEIEPLKDEASI 428
            ::   ....:..||:.:...|:|..|..:|.||     ..:..:...|.|..:|   ||.:|  .
  Fly   331 RF---SGGFMMPEPYFNGMPWSWLHRDPQRMIR-----LPSGGLPLEIPRYRRQ---PLDEE--Y 382

  Fly   429 HSSLSDRARLQKRES 443
            ||..|....|.:|::
  Fly   383 HSFKSKYEHLSRRDN 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31815NP_723979.1 DUF4778 35..329 CDD:292627 77/308 (25%)
CG4631NP_609799.1 DUF4778 46..>241 CDD:292627 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062038
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.