DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31815 and CG2898

Sequence 1:NP_723979.1 Gene:CG31815 FlyBaseID:FBgn0051815 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_572623.1 Gene:CG2898 FlyBaseID:FBgn0030195 Length:351 Species:Drosophila melanogaster

Alignment Length:238 Identity:52/239 (22%)
Similarity:91/239 (38%) Gaps:41/239 (17%)


  Fly     8 CSLTANFPWTSKIVSIGQKQPSRSTCLSQEHCLWRQRNQMEIEQLAKLVGFQPDEIDGFLFNLSL 72
            |:|..|             ..|:..|    ||.. |||:..:|..:.|......:|...||.|:.
  Fly    43 CTLCCN-------------NESKHEC----HCTC-QRNKHIVEAFSCLFRVSKFQILTTLFLLAY 89

  Fly    73 RNYSDLLKY-KECGWNGC-NVPLCYPYVCDR--YMAIFDHRGNLRSPIHARSLKSLLPLLLDYLN 133
            .....|.:: ::..|:.. ||...|..:.|.  |.::||..||...|:..::...||.|:  :|.
  Fly    90 HESRPLPRFPRDRNWSVMENVKAPYSELHDLRIYDSLFDRCGNRIDPLDQKNTYKLLRLI--FLG 152

  Fly   134 GDSPNDRKDSPIYEAYPDEHQAKCRSNIE--QSDLEAMSSSDWISQLLGNPSESKREKTGKK--- 193
            .....|::...:...|.....|.|..::.  .|.|:.:...:.:..:|.....:||..:|::   
  Fly   153 PVLVPDQQAQLLAMLYTLNAHAVCPVDLNGLLSVLQYVKLDELVCGILEQDGRAKRFHSGRQCLE 217

  Fly   194 ----------TEKPQPVM--RSELESELESESEMEKKKRKNKT 224
                      |:|...:.  |...|.....:||.:||.|:..|
  Fly   218 LCNLYQKVVATDKDAVIKKHRRRKEKSKSKDSEAQKKPRRTIT 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31815NP_723979.1 DUF4778 35..329 CDD:292627 47/212 (22%)
CG2898NP_572623.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062095
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.