DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and spint2

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis

Alignment Length:54 Identity:26/55 (47%)
Similarity:32/55 (58%) Gaps:1/55 (2%)


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :.| ||.|..|.|.|.|.||.|:.....|.||.||||:||.|:...:|.|:|||
 Frog   117 DFC-LPEAVTGPCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKC 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 26/54 (48%)
spint2NP_001039077.1 MANEC 19..104 CDD:323483
Kunitz_BPTI 118..169 CDD:278443 25/52 (48%)
KU 194..247 CDD:238057
KU 266..318 CDD:238057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.