DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and si:dkey-117n7.5

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001038359.1 Gene:si:dkey-117n7.5 ZFINID:ZDB-GENE-060503-331 Length:172 Species:Danio rerio

Alignment Length:55 Identity:21/56 (38%)
Similarity:30/56 (54%) Gaps:1/56 (2%)


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |:| |...:.|:|......|.|.|....|..|:||||.||.|.|.|:::|.:.|:
Zfish   111 ELC-LEPMSEGHCTEYVLLWYYYAVSGECRPFVYGGCGGNGNRFSSKQDCQSTCI 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 20/53 (38%)
si:dkey-117n7.5NP_001038359.1 Kunitz_BPTI 113..163 CDD:278443 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45938
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.