DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and col28a1a

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio

Alignment Length:60 Identity:26/61 (43%)
Similarity:33/61 (54%) Gaps:1/61 (2%)


  Fly    19 ALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCVE 78
            :||:..|| .....|.|......|.||.|.|.|..|.|||||||.|.||:::.|.:.||:
Zfish  1111 SLKHVGCG-QGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICKSTCVQ 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 23/53 (43%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
Collagen 266..339 CDD:189968
Collagen 311..384 CDD:189968
Collagen 491..548 CDD:189968
Collagen 529..590 CDD:189968
Collagen 561..633 CDD:189968
Collagen 700..776 CDD:189968
VWA 803..980 CDD:306576
Kunitz_BPTI 1117..1168 CDD:278443 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.