DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and tfpi2

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001015766.1 Gene:tfpi2 XenbaseID:XB-GENE-1002090 Length:219 Species:Xenopus tropicalis

Alignment Length:76 Identity:25/77 (32%)
Similarity:36/77 (47%) Gaps:1/77 (1%)


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENS 65
            ::.|:...:.|.:..:.:.....:|.|| ...|.|.||...:.||.....|..|:||||.||.|.
 Frog     5 LQALMAASLLIQVFGSPMQGNTTVCLLP-PDEGPCKALIPHYYYDRYTQTCQEFLYGGCDGNSNK 68

  Fly    66 FESQEECINKC 76
            |.|.|:|...|
 Frog    69 FLSMEDCEKFC 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 23/54 (43%)
tfpi2NP_001015766.1 Kunitz_BPTI 28..79 CDD:278443 22/52 (42%)
Kunitz_BPTI 88..139 CDD:278443
Kunitz_BPTI 148..200 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.