DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and Wfdc6b

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b MGIID:3575430 Length:155 Species:Mus musculus

Alignment Length:66 Identity:31/67 (46%)
Similarity:38/67 (57%) Gaps:1/67 (1%)


  Fly    12 ALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.....|.|..:||.||..| |.|||...||.|:....:|..|||||||||.|:|||:..|.:.|
Mouse    82 ACGRKCLDLSEDICSLPQDA-GPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

  Fly    77 V 77
            :
Mouse   146 I 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 28/53 (53%)
Wfdc6bXP_006499938.1 WAP 49..89 CDD:278522 2/7 (29%)
Kunitz_BPTI 94..145 CDD:278443 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5363
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1474897at2759
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5063
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.