DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and Wfdc6b

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001008867.1 Gene:Wfdc6b RGDID:1303277 Length:182 Species:Rattus norvegicus

Alignment Length:65 Identity:31/66 (47%)
Similarity:39/66 (59%) Gaps:1/66 (2%)


  Fly    12 ALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.....|.|..:||.||..| |.|||...||.|:.:.|:|..|||||||||.|:|.|::.|.:.|
  Rat    64 ACGKKCLDLNEDICSLPQDA-GPCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 127

  Fly    77  76
              Rat   128  127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 28/54 (52%)
Wfdc6bNP_001008867.1 WAP 32..71 CDD:278522 2/7 (29%)
Kunitz_BPTI 76..127 CDD:278443 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1474897at2759
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 1 1.000 T618062
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.