DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and ambp

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:52 Identity:22/52 - (42%)
Similarity:29/52 - (55%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.||..| |.|.|....|::|:....|.:..||||:||.|.|.|::||...|
Zfish   281 CRLPMDA-GPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 21/50 (42%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639
Kunitz_bikunin_2-like 278..332 CDD:438640 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.