powered by:
Protein Alignment Acp24A4 and ambp
DIOPT Version :9
Sequence 1: | NP_001036330.1 |
Gene: | Acp24A4 / 318936 |
FlyBaseID: | FBgn0051779 |
Length: | 78 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_957412.2 |
Gene: | ambp / 394093 |
ZFINID: | ZDB-GENE-040426-1608 |
Length: | 346 |
Species: | Danio rerio |
Alignment Length: | 52 |
Identity: | 22/52 - (42%) |
Similarity: | 29/52 - (55%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
|.||..| |.|.|....|::|:....|.:..||||:||.|.|.|::||...|
Zfish 281 CRLPMDA-GPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYC 331
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.