DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and APP

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_000475.1 Gene:APP HGNCID:620 Length:770 Species:Homo sapiens

Alignment Length:54 Identity:23/55 (42%)
Similarity:31/55 (56%) Gaps:1/55 (2%)


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |:|. ..|..|.|.|:.|||.:|.....|..|.||||.||.|:|:::|.|:..|
Human   289 EVCS-EQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVC 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 22/54 (41%)
APPNP_000475.1 A4_EXTRA 24..188 CDD:128326
GFLD subdomain. {ECO:0000255|PROSITE-ProRule:PRU01217} 28..123
APP_N 31..131 CDD:280358
Heparin-binding. {ECO:0000269|PubMed:8158260} 96..110
CuBD subdomain. {ECO:0000255|PROSITE-ProRule:PRU01217} 131..189
APP_Cu_bd 133..188 CDD:289676
Zinc-binding 181..188
Kunitz_BPTI 294..342 CDD:278443 21/49 (43%)
APP_E2 366..548 CDD:289677
Heparin-binding 391..423
Heparin-binding 491..522
Collagen-binding. {ECO:0000269|PubMed:8576160} 523..540
Beta-APP 675..713 CDD:281491
Interaction with PSEN1. {ECO:0000269|PubMed:30630874} 695..722
APP_amyloid 716..766 CDD:287486
Basolateral sorting signal 724..734
Interaction with G(o)-alpha 732..751
YENPXY motif, contains endocytosis signal. {ECO:0000269|PubMed:10383380} 757..762
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.