DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and Tfpi

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi RGDID:61914 Length:306 Species:Rattus norvegicus

Alignment Length:64 Identity:26/65 (40%)
Similarity:34/65 (52%) Gaps:1/65 (2%)


  Fly    13 LASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :.:.|.|.|.:.|.|.... |.|....:|:.|:.|...|..|.||||.||.|:||:.|||.|.|
  Rat   112 IKTTSGAEKPDFCFLEEDP-GICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTC 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 23/54 (43%)
TfpiXP_008760202.1 KU 51..104 CDD:238057
KU 122..174 CDD:238057 22/53 (42%)
Kunitz_BPTI 225..276 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.