DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and Wfikkn1

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001093924.1 Gene:Wfikkn1 MGIID:2670967 Length:552 Species:Mus musculus

Alignment Length:54 Identity:22/55 (40%)
Similarity:31/55 (56%) Gaps:1/55 (2%)


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            ::|.|| |..|.|.....||:|......|..|:|.||:||.|:||::|.|.:.|
Mouse   361 DVCALP-AVQGPCQGWEPRWAYSPLLQQCHPFVYSGCEGNSNNFETRESCEDAC 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 22/54 (41%)
Wfikkn1NP_001093924.1 WAP 34..80 CDD:278522
KAZAL_FS 124..161 CDD:238052
I-set 196..284 CDD:254352
Ig_3 204..284 CDD:143242
KU 311..356 CDD:294074
KU 361..413 CDD:197529 21/53 (40%)
NTR_like 431..541 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45938
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.