DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and Wfdc6a

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a MGIID:2684968 Length:193 Species:Mus musculus

Alignment Length:57 Identity:26/58 (45%)
Similarity:35/58 (60%) Gaps:1/58 (2%)


  Fly    20 LKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |:.::|.||... |.|||...||.|:.:.::|..|||||||||.|:|.|:..|...|
Mouse   129 LRQDVCSLPQDP-GPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVC 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 25/54 (46%)
Wfdc6aXP_011237710.1 WAP 89..128 CDD:278522
Kunitz_BPTI 133..185 CDD:278443 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4295
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5363
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1474897at2759
OrthoFinder 1 1.000 FOG0000100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.