DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:82 Identity:24/82 - (29%)
Similarity:36/82 - (43%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLP------AAANGNCLALFSRWSYDAQYNVCFNFIYGGC 59
            |.||:.....|...|..::.....|.||      ...||.   ...|:.:|.:.|:...|.|.||
 Worm     1 MNLLLTFLATILCVSELVSTLQPECKLPLDMGKTPCKNGK---KEIRYHFDQKSNIPLAFEYSGC 62

  Fly    60 QGNENSFESQEECINKC 76
            .||:|:|:::.||...|
 Worm    63 GGNKNNFKTESECRFTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 18/56 (32%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 18/56 (32%)

Return to query results.
Submit another query.