DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and C02F12.5

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:75 Identity:25/75 - (33%)
Similarity:36/75 - (48%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLILLFVFIALASNSLALKNEI-CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSF 66
            |||.||:...|.  ..|..:|: .|...:.|...    ::|.||::...|:.:.|.||....|||
 Worm     6 LLIQLFLVPVLC--QYACSSELKFGTACSENKTS----TKWYYDSKLLFCYPYKYLGCGEGSNSF 64

  Fly    67 ESQEECINKC 76
            ||.|.|:..|
 Worm    65 ESNENCLESC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 16/50 (32%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 15/43 (35%)

Return to query results.
Submit another query.