DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp24A4 and wfikkn1

Sequence 1:NP_001036330.1 Gene:Acp24A4 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_002932495.1 Gene:wfikkn1 XenbaseID:XB-GENE-923256 Length:545 Species:Xenopus tropicalis

Alignment Length:54 Identity:24/55 (44%)
Similarity:34/55 (62%) Gaps:1/55 (2%)


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            ::|.|| ...|.|.....||:|......||:|:|||||||.|:|||::.|.::|
 Frog   359 DLCSLP-PVRGPCKVPEWRWAYSTMMRQCFSFVYGGCQGNLNNFESKQACEDRC 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 24/54 (44%)
wfikkn1XP_002932495.1 WAP 27..73 CDD:278522
KAZAL_FS 119..>151 CDD:238052
IG_like 195..283 CDD:214653
Ig 203..283 CDD:299845
KU 302..353 CDD:238057
Kunitz_BPTI 361..411 CDD:278443 23/51 (45%)
NTR_like 429..534 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.