DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosbeta5R2 and Prosalpha2

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:192 Identity:47/193 (24%)
Similarity:83/193 (43%) Gaps:23/193 (12%)


  Fly    64 VQIDF-----DHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADC 123
            ||:::     ..|..:||.:...|:::..:::..| .|....|:|:|..:..:|....:|...|.
  Fly    20 VQLEYALAAVSGGAPSVGIIASNGVVIATENKHKS-PLYEQHSVHRVEMIYNHIGMVYSGMGPDY 83

  Fly   124 TYWDRALTRECR----LHELRYKERLPVQSAAKYISNVAAEYKGMG----LCMGMMLAGWSPEGP 180
                |.|.::.|    .:.|.|||.:||....:.::.:..||...|    ..:.:::.||..:.|
  Fly    84 ----RLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRP 144

  Fly   181 SLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSG 242
            .|...|.:|.....|..|:|..|.|....|:..|..||..::|...|.|     |:.:.|.|
  Fly   145 YLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAIL-----TLKEGFEG 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 47/193 (24%)
proteasome_beta_type_5 72..259 CDD:239730 44/180 (24%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 47/193 (24%)
proteasome_alpha_type_2 6..231 CDD:239719 47/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78894737
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.