DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and nat8b

DIOPT Version :8

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_017949229.1 Gene:nat8b / 100124951 -ID:- Length:237 Species:Xenopus tropicalis

Alignment Length:54 Identity:12/55 (22%)
Similarity:28/55 (51%) Gaps:4/55 (7%)


  Fly    78 LTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMR--ISNRAAYQLYTSLGY 129
            ::|..::|.||:..||..  .::|..:...|.::.:.  :....|.::|.|:|:
 Frog   155 MSVRKDFRGLGIGKALSR--EVLSFARQNQYRSVILNTLMVQHEAQKMYESVGF 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 12/55 (22%)
Acetyltransf_1 52..129 CDD:278980 12/53 (23%)
nat8bXP_017949229.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.