DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kdm4B and NTO1

Sequence 1:NP_001260942.1 Gene:Kdm4B FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_015356.1 Gene:NTO1 SGDID:S000006235 Length:748 Species:Saccharomyces cerevisiae

Alignment Length:510 Identity:89/511 (17%)
Similarity:161/511 (32%) Gaps:176/511 (34%)


  Fly    57 DLDALNVTIPAPICQVVTGKQGYYQQINIQKKPLTVKQFSELASTERYAT----PKH---FDFED 114
            |.|.||..:....|.:.. .|..|..|.|.:.....::.  :.|...:||    |.|   |...|
Yeast   273 DSDNLNTIVFCDGCDIAV-HQECYGIIFIPEGKWLCRRC--MISKNNFATCLMCPSHTGAFKQTD 334

  Fly   115 ------------LERKYWKNITYVAPIYGADVSGSITDTDQDSWNIN------RLGTILD----- 156
                        |...|:.|:.|:.||.|      :.:.....|.:|      ::|..:.     
Yeast   335 TGSWVHNICALWLPELYFSNLHYMEPIEG------VQNVSVSRWKLNCYICKKKMGACIQCFQRN 393

  Fly   157 ---------------YVNK---------------DYNIQ--------------IDGVNTAYLYFG 177
                           |::|               .|:::              |:|:|.|..||.
Yeast   394 CFTAYHVTCARRAGLYMSKGKCTIQELASNQFSQKYSVESFCHKHAPRGWQTSIEGINKARKYFS 458

  Fly   178 M---WKTTFAWHTE--DMDLYSINYLHFGAPKTWYVVPPECGRKLEKVANQYF-----PA-SYKN 231
            :   .:|....|.|  |......|...:..|....|.|......|:||.: :|     || ::..
Yeast   459 LLSTLQTETPQHNEANDRTNSKFNKTIWKTPNQTPVAPHVFAEILQKVVD-FFGLANPPAGAFDI 522

  Fly   232 CNAY-LRHKMTLISPQILKQHDVPVSKITQEAGEIMITFPFGYHAGFNHGFNCAESTNFAMERWI 295
            |..: ::.::|..:|......:..:..:|:|..:..|.|                 .|..:|   
Yeast   523 CKYWSMKRELTGGTPLTACFENNSLGSLTEEQVQTRIDF-----------------ANDQLE--- 567

  Fly   296 EYGKRAVQCTCSNDMVKI-SMDTFVKRFQSDRYDLWMEGRDVGRHPEDPPNAVLSAAPLPPHLDV 359
                         |:.:: .:.|.||:.......|....:.|....:.|...:|....    ||:
Yeast   568 -------------DLYRLKELTTLVKKRTQASNSLSRSRKKVFDIVKSPQKYLLKINV----LDI 615

  Fly   360 LLCD---KKMKKQCNPTKAKSFKERNPDLDLDEIQQNPNVPDDVKAMLKESVL----TLDTGDLA 417
            .:..   |.:::.....|.....|:....|.|.:|           :.||.::    .|:|    
Yeast   616 FIKSEQFKALERLVTEPKLLVILEKCKHCDFDTVQ-----------IFKEEIMHFFEVLET---- 665

  Fly   418 TDEADFPNEDAMSLQSPANLKTKQE------LLEYID-------DGTEDDDEEED 459
                 .|.  |..:....:.|.|::      |:|::|       |...:||:.|:
Yeast   666 -----LPG--ASRILQTVSSKAKEQVTNLIGLIEHVDIKKLLSRDFIINDDKIEE 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224 24/128 (19%)
NTO1NP_015356.1 COG5141 18..748 CDD:227470 89/511 (17%)
EPL1 <145..222 CDD:287484
PHD_BRPF_JADE_like 265..310 CDD:276967 9/38 (24%)
ePHD_BRPF 320..438 CDD:277140 17/124 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.