DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kdm4B and Kdm4c

Sequence 1:NP_001260942.1 Gene:Kdm4B FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001165566.1 Gene:Kdm4c MGIID:1924054 Length:1071 Species:Mus musculus

Alignment Length:650 Identity:280/650 (43%)
Similarity:368/650 (57%) Gaps:118/650 (18%)


  Fly     8 RIKVFRPTWEEFKDFPKYVAYMESQGAHKAGLAKVVPPPEWVPRRSGYADLDALNVTIPAPICQV 72
            :|..|||:.|||::|.||:|||||:|||:||||||:||.||.||:. |.|:|  |:.|||||.|:
Mouse    32 KIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC-YDDID--NLLIPAPIQQM 93

  Fly    73 VTGKQGYYQQINIQKKPLTVKQFSELASTERYATPKHFDFEDLERKYWKNITYVAPIYGADVSGS 137
            |||:.|.:.|.|||||.:|||:|.:||::.:|.||::.|:||||||||||:|:||||||||::||
Mouse    94 VTGQSGLFTQYNIQKKAMTVKEFRQLANSSKYCTPRYLDYEDLERKYWKNLTFVAPIYGADINGS 158

  Fly   138 ITDTDQDSWNINRLGTILDYVNKDYNIQIDGVNTAYLYFGMWKTTFAWHTEDMDLYSINYLHFGA 202
            |.|...|.|||.||.|:||.|.::..|.|:||||.|||||||||||||||||||||||||||||.
Mouse   159 IYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGE 223

  Fly   203 PKTWYVVPPECGRKLEKVANQYFPASYKNCNAYLRHKMTLISPQILKQHDVPVSKITQEAGEIMI 267
            ||:||.:|||.|::||::|..:||:|.:.|:|:||||||||||.:||::.:|..||||||||.||
Mouse   224 PKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMI 288

  Fly   268 TFPFGYHAGFNHGFNCAESTNFAMERWIEYGKRAVQCTCSNDMVKISMDTFVKRFQSDRYDLWME 332
            |||:|||||||||||||||||||..|||:|||.|..|||.|||||||||.|||:||.|||.:|.:
Mouse   289 TFPYGYHAGFNHGFNCAESTNFATVRWIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQ 353

  Fly   333 GRDVGR--HPEDPPNAVLSAAPLPPHLDVLLCDKKMKKQCNPTKAKSFKERNPDLDLDEIQQNPN 395
            |:|:..  |.:..|.:.       |.:...|  ::.||...|  .||.:...|      :.:.|.
Mouse   354 GKDIYTIDHTKPTPEST-------PEVKTWL--QRKKKLRKP--PKSLQGNKP------LCKRPK 401

  Fly   396 VPDDVKAMLKESVLTLDTGDLATDEADFPNED-AMSLQSPANLKTKQELLEYIDDG-TEDDDEEE 458
            ..:|                  .:.|:|..|: |.....|.:||..::..:.:..| .|:...:|
Mouse   402 PEED------------------EEFAEFSGEEGANPAMGPRHLKVTEKPEKALKLGKLEESSAKE 448

  Fly   459 DFKRRKQKRRYDADYDDDWLASKRKTNSRNNRGRSPRTKDDRSISPASSTSSTSRGARRGKASGT 523
            ....|.|       .|...|                   :|..:|.....||             
Mouse   449 ALDTRIQ-------VDQSLL-------------------NDTKLSGKGCISS------------- 474

  Fly   524 PRKTPARRKKDSITTS-PAVSSAATAVKTPTSAVVAGTTSIATTTTPPADGGGDAKKERQSLQFM 587
                       |:|.. |...:.|:||.:| |.:..|...|      |...|..|.||...|:.:
Mouse   475 -----------SVTAEIPPEDNRASAVISP-SQLKEGADCI------PLSHGHQAGKESHLLKIL 521

  Fly   588 Q-QSRKFEGKIPKLSQTSAATGGATAAAEASTSKSSQGQQQQIVYVNMLPAA-----NTLNGIPQ 646
            : :|.|....:|:  .....|.|.....|...|....|:         :|.|     |.|| ||:
Mouse   522 KLESPKIPSPLPE--SNKVLTEGEENDEEGHGSNLEPGE---------IPEALSEERNGLN-IPK 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526 23/33 (70%)
JmjC 173..289 CDD:202224 88/116 (76%)
Kdm4cNP_001165566.1 JmjN 33..74 CDD:301729 28/41 (68%)
JmjC 194..310 CDD:202224 88/116 (76%)
PHD_SF 660..761 CDD:304600
PHD_SF 770..879 CDD:304600
TUDOR 892..948 CDD:197660
TUDOR 950..1005 CDD:197660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C313908858
eggNOG 1 0.900 E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000410
OrthoInspector 1 1.000 T131003
orthoMCL 1 0.900 OOG5_127917
Panther 1 1.100 O PTHR10694
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2594
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.