DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and TMED9

DIOPT Version :10

Sequence 1:NP_788617.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_059980.2 Gene:TMED9 / 54732 HGNCID:24878 Length:235 Species:Homo sapiens


Alignment Length:206 Identity:128/206 - (62%)
Similarity:163/206 - (79%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVE 71
            :|.|:|.:......|||||.:||:||||||:||||.||.||:.:|||.:...:.|::||:||.||
Human    24 TLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVE 88

  Fly    72 VRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYA 134
            |:|.:||::|:|.|.|:||.:|||||||||.||:.||||.:  |:|..|||||||||||||.|||
Human    89 VKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYA 153

  Fly   135 HVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMG 199
            .:|.|:||:|||||:|||::|||||.|||||||:||||||.||||||.||||||:.||::||.:|
Human   154 EIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIG 218

  Fly   200 FW---HLFNLF 207
            .|   ||.:.|
Human   219 VWQMRHLKSFF 229

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_788617.1 EMP24_GP25L 20..206 CDD:426051 124/190 (65%)
TMED9NP_059980.2 EMP24_GP25L 37..230 CDD:426051 125/193 (65%)
Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 121..160 25/38 (66%)
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235 1/2 (50%)