DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tengl1 and endog

Sequence 1:NP_722780.1 Gene:Tengl1 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001017202.1 Gene:endog XenbaseID:XB-GENE-998565 Length:293 Species:Xenopus tropicalis

Alignment Length:237 Identity:67/238 (28%)
Similarity:109/238 (46%) Gaps:41/238 (17%)


  Fly    79 GIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYG----------------- 126
            |:.::|.|..:.:...|:  :|.|:|.|.....|:.|.  ||...::|                 
 Frog    60 GLTRFGLPGLSQLKSRES--YVLSYDPRLRGPAWVLEH--LSPERLHGSAERQGCDFQEDVSVHQ 120

  Fly   127 --------------DSTSVAPAGAFGQSEAA--RVFFLSNIRPFLNRGFNLTVWDRLLQYVHEMS 175
                          |...:|.|.....|:.|  ..|.||||.| .|...|...|:.|.:|...::
 Frog   121 YHRAANSDFKGSGFDRGHLAAAANHKWSQKAMDETFILSNIYP-QNPHLNQKAWNNLERYCRSLT 184

  Fly   176 QRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVM 240
            :::..||..||.::|||.....:.::::|......|||||||||::|:: ||:|:.  ...:|||
 Frog   185 KKNKNVYVCTGPLFLPRREPDGNMYVKYQVIGSNNVAVPTHFFKVVVLE-KFSGEI--ELRSYVM 246

  Fly   241 PNSPLNNNVELKTLLSDVREIENATGLRFFEGLDRNFVNTQA 282
            ||.|::..:.|:..|..:..||.|.||.|...:.:|..|.:|
 Frog   247 PNHPVDEQIPLERFLVPIESIERAAGLLFVPNILKNTNNLKA 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 60/210 (29%)
endogNP_001017202.1 NUC 75..282 CDD:214683 61/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.654 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.