DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and endog

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001017202.1 Gene:endog / 549956 XenbaseID:XB-GENE-998565 Length:293 Species:Xenopus tropicalis


Alignment Length:237 Identity:67/237 - (28%)
Similarity:109/237 - (45%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYG----------------- 126
            |:.::|.|..:.:...|:  :|.|:|.|.....|:.|.  ||...::|                 
 Frog    60 GLTRFGLPGLSQLKSRES--YVLSYDPRLRGPAWVLEH--LSPERLHGSAERQGCDFQEDVSVHQ 120

  Fly   127 --------------DSTSVAPAGAFGQSEAA--RVFFLSNIRPFLNRGFNLTVWDRLLQYVHEMS 175
                          |...:|.|.....|:.|  ..|.||||.| .|...|...|:.|.:|...::
 Frog   121 YHRAANSDFKGSGFDRGHLAAAANHKWSQKAMDETFILSNIYP-QNPHLNQKAWNNLERYCRSLT 184

  Fly   176 QRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVM 240
            :::..||..||.::|||.....:.::::|......|||||||||::|:: ||:|:.  ...:|||
 Frog   185 KKNKNVYVCTGPLFLPRREPDGNMYVKYQVIGSNNVAVPTHFFKVVVLE-KFSGEI--ELRSYVM 246

  Fly   241 PNSPLNNNVELKTLLSDVREIENATGLRFFEGLDRNFVNTQA 282
            ||.|::..:.|:..|..:..||.|.||.|...:.:|..|.:|
 Frog   247 PNHPVDEQIPLERFLVPIESIERAAGLLFVPNILKNTNNLKA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 60/209 (29%)
endogNP_001017202.1 NUC 75..282 CDD:214683 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.