DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tengl1 and pnu1

Sequence 1:NP_722780.1 Gene:Tengl1 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_594598.2 Gene:pnu1 PomBaseID:SPAC17C9.08 Length:322 Species:Schizosaccharomyces pombe

Alignment Length:303 Identity:76/304 (25%)
Similarity:123/304 (40%) Gaps:56/304 (18%)


  Fly     7 GIIGILATAGSFFALGAY--YQHIDVM-------------RKIRRLEQRNPHAYF---------I 47
            |:|.|.|.:|..|....|  ||..||.             |.:..:...|...:|         .
pombe    10 GLIAIGAISGVTFTHFYYKGYQGSDVPDLTPRYTKFDSAGRALESIYDFNATKFFQYGIPGPVAD 74

  Fly    48 RRKLYALLGIFAVRPDNSEFDVDT---DDCHKLGGIMKYG--FPSTNDITINETFDFVTSFDRRN 107
            :|..:..:.:|..|..|..:..:|   :..::..|..:|.  .|..|   |.|.|..... |.|.
pombe    75 QRVNHGYMSVFDRRTRNPFYTAETITQESLNQRKGNRRYSEFVPDDN---IPEMFQAKLG-DYRG 135

  Fly   108 SAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVH 172
            |.       .|..::|...|.       .|.|......|:|||:.|.:..|||...|.....:..
pombe   136 SG-------YDRGHQVPAADC-------KFSQEAMNETFYLSNMCPQVGDGFNRNYWAYFEDWCR 186

  Fly   173 EMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTM-----VAVPTHFFKILVIDKKFAGDTI 232
            .::.::|:|...||.:|||::.:...|.:::    |.:     |||||||||:::.:|.....:.
pombe   187 RLTSKYGSVTIMTGPLYLPKKNERGQWEVQY----RVIGNPPNVAVPTHFFKVIIAEKSGEPTSS 247

  Fly   233 PYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGLDR 275
            |...|:|:||.|:.:|..||.....|..:|.|:||.....:.:
pombe   248 PSVAAFVLPNKPIADNFPLKNFAVPVEVVERASGLEILSNVPK 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 50/182 (27%)
pnu1NP_594598.2 NUC1 5..309 CDD:224777 76/304 (25%)
NUC 78..289 CDD:214683 61/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 1 0.910 0.941 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.