DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tengl1 and exog

Sequence 1:NP_722780.1 Gene:Tengl1 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_004915758.1 Gene:exog XenbaseID:XB-GENE-981839 Length:226 Species:Xenopus tropicalis

Alignment Length:67 Identity:24/68 (35%)
Similarity:41/68 (60%) Gaps:3/68 (4%)


  Fly   211 VAVPTHFFKILVIDKKFAGDTIPYA-EAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGLD 274
            |:||:|.:|::::..|  |...|.| .|:|:||||:..:.:|......:.::|..:||.||..||
 Frog    82 VSVPSHLYKVILVRGK--GSEQPLAVGAFVVPNSPIGFDRQLPEYQVQLEDLEKMSGLVFFPQLD 144

  Fly   275 RN 276
            |:
 Frog   145 RD 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 23/65 (35%)
exogXP_004915758.1 NUC <75..146 CDD:294067 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.