DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6CL and cox6c

DIOPT Version :10

Sequence 1:NP_001285640.1 Gene:COX6CL / 318868 FlyBaseID:FBgn0051644 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001191053.1 Gene:cox6c / 494577 ZFINID:ZDB-GENE-040724-95 Length:76 Species:Danio rerio


Alignment Length:66 Identity:21/66 - (31%)
Similarity:32/66 - (48%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDRMMSGGYLSSCP 77
            |..|..|:...::.:|..|:|.|...|....::|||:.|.:||:.||....|:.|...|...|..
Zfish     8 MRGLLAKRLRFHLPIAFALSLCAAAAFKFTVSDPRKKAYADFYTQYDSTKEFNAMREAGIFESAR 72

  Fly    78 P 78
            |
Zfish    73 P 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6CLNP_001285640.1 COX6C 9..76 CDD:460756 19/62 (31%)
cox6cNP_001191053.1 CcO_VIc 3..68 CDD:438623 19/59 (32%)

Return to query results.
Submit another query.