DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6CL and Cox6c

DIOPT Version :10

Sequence 1:NP_001285640.1 Gene:COX6CL / 318868 FlyBaseID:FBgn0051644 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_444301.1 Gene:Cox6c / 12864 MGIID:104614 Length:76 Species:Mus musculus


Alignment Length:30 Identity:13/30 - (43%)
Similarity:15/30 - (50%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PRKRKYRNFYSTYDPMDAFDRMMSGGYLSS 75
            |||:.|..||..||.|..|:.|...|...|
Mouse    45 PRKKAYAEFYRNYDSMKDFEEMRKAGIFQS 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6CLNP_001285640.1 COX6C 9..76 CDD:460756 13/30 (43%)
Cox6cNP_444301.1 COX6C 7..75 CDD:460756 13/30 (43%)

Return to query results.
Submit another query.