DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and FASTKD1

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001308975.1 Gene:FASTKD1 HGNCID:26150 Length:847 Species:Homo sapiens

Alignment Length:908 Identity:189/909 (21%)
Similarity:361/909 (40%) Gaps:183/909 (20%)


  Fly    69 PREQDALLTRLEEAKTGNQILDVLESCDG-LQSSHVVMGISLLWNIYHDAEQASKDA--ITDRVL 130
            |...:.|:.::.:.....|:...:|.... |....|.....:||.:........|:|  :.|...
Human    33 PISCEPLIIQMNKCTDEEQMFGFIERNKAILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQ 97

  Fly   131 LNVLPKLAPYVHQLEIDDLSRCYLYLRKM-----HIPNSEAVVEAVLTRSLQLIESQVDDEVIPL 190
            ...|..||....:|..||.....||:.:.     |.|    :|||::|.:.:.:|.      ..:
Human    98 FLTLHNLATNKFKLMNDDTLVNVLYVTQQFAGEAHDP----LVEALVTEAWRRLER------FDI 152

  Fly   191 TSLSRLSVGINLERDFFTPLVCRNFIPHLEHHINWCRSAEQVRLLSTCLFQLHFLIDEELFTRFK 255
            ..||..|..:..:..:|:||:.:  |..:.|..  ..:.:.:..||..:..:..||... |.:..
Human   153 KLLSEFSSCLADQHLYFSPLMGK--IADIVHRN--LETTQDLSSLSVLMVNISSLISRH-FQQQL 212

  Fly   256 LRLTEMMQSGVLSSETPKALLKVIHMLNIPVWSQTHTQLIREVMLVLRPCIHQ--------MESA 312
            :..||::...:.|||           :|:   :::..:.:|.|....:|.:.:        ::..
Human   213 VNKTELLFDTIDSSE-----------VNV---AKSIAKFLRNVRYRYQPLLERCNNVFLSNVDHL 263

  Fly   313 DLKSICR-----TFLHHQEPAALIEPLKKALE--KLLQEEGTADALFCAV-PFATPLQRDQYLHQ 369
            ||.||.:     .||.......:|...||..|  .|.....:...||.|: |.|.|.::.|.  :
Human   264 DLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPASFVKLFVALGPIAGPEEKKQL--K 326

  Fly   370 FKELLYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYWSGVVKELESCPEKHLH----LRFLRH 430
            ...||.||:.     ......:||.|:  .|:|..|   |.::|.:.|...|||.    |..|:.
Human   327 STMLLMSEDL-----TGEQALAVLGAM--GDMESRN---SCLIKRVTSVLHKHLDGYKPLELLKI 381

  Fly   431 CQR--YMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAGRLPAKFARLASFVLAYGQTPLAWKK 493
            .|.  :::|...        |...||..:.::.:::..   :|.:.:     ||....:.|....
Human   382 TQELTFLHFQRK--------EFFAKLRELLLSYLKNSF---IPTEVS-----VLVRAISLLPSPH 430

  Fly   494 FPNFLLSKMLAMAPQLGIQDCFLLSRGMQIASELRFRQH----LPALAGMQLSTMDSI------- 547
            .....:|::.|:.||     |.|.:......|.||:.||    |..:...||..:..:       
Human   431 LDEVGISRIEAVLPQ-----CDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLLQKLDHYGRQR 490

  Fly   548 -----LIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQALAQYKNLHCNDLNSRV 607
                 .:....:.|:..:.:....|.|..::.||.|                    ..:|:|...
Human   491 LQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQH--------------------FMDDINYIN 535

  Fly   608 VRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMP--------ASVEA 664
            |.::|...:::::....||:.:.:...:|.:.:...|:..::.....|.|.|        ..|:.
Human   536 VGEIASFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQH 600

  Fly   665 LNHASEVLLRDFDQMSGLSVVQACLALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPE 729
            ||....:|       ....:|....:|...:..||.|:..:|.:||:.|::.::::.  ..:...
Human   601 LNSYLGIL-------DPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEIL--SPSRSA 656

  Fly   730 RVLNLVMQLNRTVCLDFPEANVPWFQQNYIEAQISKKSLIPSEST-TEVKQLLHQLLQNDKHFRC 793
            ||...:|:|||:|||:.||..:|||...:  .|...|.:...:.| .::.::|.::|......:.
Human   657 RVQFHLMELNRSVCLECPEFQIPWFHDRF--CQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKA 719

  Fly   794 NHTTPYGYQIDFVIHFDRDKNPIP--------------------------APPVEATMLDRITKV 832
            :..|||.:::||....|:.|.|:|                          .||       ...::
Human   720 SVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPP-------GAERI 777

  Fly   833 AILLLKLDSFCENDLTALRGPESLKMRHLEMMGYKVMQINEHDWNSKYMASSTAKANYLK-CL 894
            |:..|...:.|.| :..::|..::|.||||::||:|:||::.:|||..:::..|:.:||: |:
Human   778 ALEFLDSKALCRN-IPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECI 839

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 15/74 (20%)
FAST_2 736..816 CDD:285557 25/81 (31%)
RAP 834..894 CDD:214932 21/61 (34%)
FASTKD1NP_001308975.1 FAST_1 575..642 CDD:284217 15/74 (20%)
FAST_2 662..742 CDD:285557 25/82 (30%)
RAP 779..838 CDD:214932 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53990100
eggNOG 1 0.900 E1_28HV5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4785
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D352329at2759
OrthoFinder 1 1.000 FOG0006262
OrthoInspector 1 1.000 T1073462
orthoMCL 1 0.900 OOG5_139045
Panther 1 1.100 O PTHR21228
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.