DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and FASTKD5

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_068598.1 Gene:FASTKD5 HGNCID:25790 Length:764 Species:Homo sapiens

Alignment Length:820 Identity:146/821 (18%)
Similarity:253/821 (31%) Gaps:290/821 (35%)


  Fly   222 HINWCRSAEQVRLLSTCLFQLHFLIDEELFTRFKLRLTEMMQSGVLSSETPKALLKVIHMLNIPV 286
            ||:.|.||::|:.:.:.......|.........:...|...::..|...:|:|  ..:...::.|
Human    46 HISLCHSAKKVKNICSTFSSRRILTTSSAHPGLEFSKTSSSKASTLQLGSPRA--TGVDEEDVEV 108

  Fly   287 WSQTHTQLIREVMLVLRP--CIHQ---MESADLKSIC--RTFLH-------HQEPAALIEPLKKA 337
            :......   .|.|.|||  .:|.   .|::.|.|:.  ...||       :.:...:::.|.| 
Human   109 FDSFENM---RVFLQLRPEYRVHSYNASETSQLLSVSEGELILHKVRVNQNNLQAQVIVDYLCK- 169

  Fly   338 LEKLLQEE------GTADALFCAVPFATPLQRDQYLHQFKELLYSEEAWQQPNASGHLFSVLRA- 395
            |..|..|:      .|:.||.|            .|...|..|:..:         .|.:||:| 
Human   170 LSSLPAEQHPVLLGSTSFALLC------------QLSVKKIQLFDTQ---------DLINVLKAF 213

  Fly   396 -----------LKVSDIEFCNTYWSGVVKELESCPEKHLHL-----RFLRHCQRYMNFNNNLGGT 444
                       |.|.:.:.|:..|...:.:|....:...:|     |||.....|:|.:      
Human   214 VILGIPHSHSMLDVYETKCCHQVWEMNMDQLLLVADLWRYLGRKVPRFLNIFSSYLNLH------ 272

  Fly   445 YRHLELERKLSRMCMNAIEHDIAGRLPAKFARLASFVLAY---------GQTPLAWKK----FPN 496
            ::.|.|.:.:..:.:......::..|..|   |.|.:|.|         |...|.:.|    ...
Human   273 WKDLSLSQLVHLIYVIGENRQVSQDLMQK---LESLILKYIDLINLEEVGTICLGFFKSSTNLSE 334

  Fly   497 FLLSKM--LAMAPQLGIQDCFLLSRGM-QIASELRFR----------------QHLPALAGMQLS 542
            |::.|:  ||.|   .||  .|.||.: .|....||.                |.:|:| |:| .
Human   335 FVMRKIGDLACA---NIQ--HLSSRSLVNIVKMFRFTHVDHINFMKQIGEIAPQRIPSL-GVQ-G 392

  Fly   543 TMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQALAQYKNLHCNDLNSRV 607
            .|...|...|.|.|.:.   .:||...|:..|.                      .||   .|:.
Human   393 VMHLTLYCSALRFLNEG---VMNAVAASLPPRV----------------------AHC---RSKD 429

  Fly   608 VRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVL 672
            |..:.::|...|:..|...|...:.|||.|..                  ||...:...|....|
Human   430 VAKILWSFGTLNYKPPNAEEFYSSLISEIHRK------------------MPEFNQYPEHLPTCL 476

  Fly   673 LRDFDQMSGLSVVQACLALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPERVLNLVMQ 737
                            |.|.|.:..|.:||:......|::..::..:....|..|         .
Human   477 ----------------LGLAFLEYFPVELIDFALSPGFVRLAQERTKFDLLKELY---------T 516

  Fly   738 LNRTVCLDFPE--------------ANVPWFQQNYIEAQISKKSLIPSESTTEVKQLLHQLLQND 788
            |:.||.::.|:              :.:.|:        :::|.:.......|...||..:|...
Human   517 LDGTVGIECPDYRGNRLSTHLQQEGSELLWY--------LAEKDMNSKPEFLETVFLLETMLGGP 573

  Fly   789 KHFRCNHTTPYGYQIDFVIHFDRDKNPIP----APPVE--------------------------- 822
            ::.:.:...|:....|..:..|.:..|:|    |.|.|                           
Human   574 QYVKHHMILPHTRSSDLEVQLDVNLKPLPFNREATPAENVAKLRLEHVGVSLTDDLMNKLLKGKA 638

  Fly   823 -------------------------------------------------ATMLDRITKVAILLLK 838
                                                             |.|.....|:|:....
Human   639 RGHFQGKTESEPGQQPMELENKAAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQFTN 703

  Fly   839 LDSFC--ENDLTALRGPESLKMRHLEMMGYKVMQINEHDW 876
            .:.:|  ..||..|   .::|.|.|..:||:|::::..:|
Human   704 RNQYCYGSRDLLGL---HNMKRRQLARLGYRVVELSYWEW 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 11/66 (17%)
FAST_2 736..816 CDD:285557 14/94 (15%)
RAP 834..894 CDD:214932 11/46 (24%)
FASTKD5NP_068598.1 FAST_1 431..499 CDD:310980 19/102 (19%)
FAST_2 514..601 CDD:312018 15/104 (14%)
RAP 699..758 CDD:214932 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.