DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and fastk

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001164290.1 Gene:fastk ZFINID:ZDB-GENE-070912-680 Length:914 Species:Danio rerio

Alignment Length:698 Identity:124/699 (18%)
Similarity:226/699 (32%) Gaps:227/699 (32%)


  Fly   217 PHLEHHINWCRSAEQV------RLLSTCLFQLHFLIDEELFTRFKLRLTEMMQSGVLSSETPKAL 275
            ||.:.|.:...|.::.      ::.....|.:..|||........||........:..:..|.||
Zfish   115 PHYQPHAHLHHSKKKTWNFIHEKMSYDTFFTMKRLIDRSRSVDEVLRWVTQNPGKISHNHYPIAL 179

  Fly   276 LKVIHMLNIPVWSQTHTQ--------------------------LIREVMLVLRPCIHQMESADL 314
            .|:..:|   |..|...|                          .:|::          :::.|.
Zfish   180 QKIGQLL---VLHQAGGQAGGAAGGGAGEGVLAASSAAGGSGENTVRQI----------LDNQDF 231

  Fly   315 KSICRTFLHH-------------QEPAALIEPLKKALEKLLQEEGTADALFCAVPFATPLQRDQY 366
            :::|...::.             ...|||..|....:.::|:||..|                 .
Zfish   232 QTLCDAIVNDCSKFDNFSIVNCLYAVAALGLPSDSQIVQVLEEESQA-----------------R 279

  Fly   367 LHQFKE----LLYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYWSGVVKELESCPEKHLHLRF 427
            |.||.:    :::|......|::...|                         :|||         
Zfish   280 LSQFNQKDISMVFSSSMKLHPSSQHPL-------------------------IESC--------- 310

  Fly   428 LRHCQRYMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAGRLPAKFARLASFVLAYGQTPLAWK 492
                         |.|..:::|.||....:.:                     :|:|.:|  .|:
Zfish   311 -------------LAGLEKNIERERHPQTLFL---------------------LLSYYRT--KWR 339

  Fly   493 KFPNFLLSKMLAMAPQLGIQDCFLLSRGMQIASELRFRQHLPALAGMQLSTMDSILIGCAERHLR 557
            .    |.:...|...||.:....|......:||....|.|       :::.:|.:|..||    |
Zfish   340 A----LRAADTASPEQLVVNRKILRLVKHTLASVSSVRDH-------EMALLDEMLSACA----R 389

  Fly   558 DAEKDPLN---ASEL------SMIVRTLSHR--KKLKNTVVYNQAL-AQYKNLHCNDLNSRVVRD 610
            :|....|.   :|.|      ...|.:|:..  ||:.:...|..|| |:|...|    ..|..| 
Zfish   390 EASNKSLELIFSSHLFYQNRQEKFVSSLAEELPKKVDSITPYTMALIAKYIARH----RLRETR- 449

  Fly   611 MAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRD 675
                          ||:::..::.::.:::....::|::.....:.|.||:........|::|..
Zfish   450 --------------LLDTIADFLVKKGEYLDSKVIQKLVFPFSRMSYRPANEAQFFSKLEMVLEL 500

  Fly   676 FDQMSGLSVVQACLALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPERVLNLVMQLNR 740
            ....|.|:.|...::|......|..::::||...||..:   |...|  |....|.|:|   |:.
Zfish   501 KALSSPLATVNILMSLFQLGHFPGLVLHRVFSPSFISNV---INSPY--ALIVRRYLSL---LDA 557

  Fly   741 TVCLDFPEANVPWFQQNY-------------IEAQISKKSLIPSESTTEVKQLLHQLLQNDKHFR 792
            .|.|::.:...|..|..:             :..:.|.|.|        |.:.|.||: .:..::
Zfish   558 AVELEYRDYTGPRLQDTHKVLMFDHALTADEVNRKYSYKGL--------VAEALRQLV-GEHGYK 613

  Fly   793 CNHTTPYGYQIDFVIHFDRDKN--PIPAPPVEATMLDRITKVAILLLK 838
            .:.....||..||::..|....  ||......|::....|...:|.||
Zfish   614 QDEVLAPGYYTDFLLWVDSTGRVLPIRTGTPAASLAASSTPCVVLNLK 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 15/66 (23%)
FAST_2 736..816 CDD:285557 18/95 (19%)
RAP 834..894 CDD:214932 3/6 (50%)
fastkNP_001164290.1 FAST_1 471..538 CDD:284217 15/67 (22%)
FAST_2 552..637 CDD:285557 19/97 (20%)
RAP 853..908 CDD:214932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7659
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.