DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and Fastkd1

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_796218.2 Gene:Fastkd1 MGIID:2444596 Length:829 Species:Mus musculus

Alignment Length:891 Identity:199/892 (22%)
Similarity:391/892 (44%) Gaps:156/892 (17%)


  Fly    69 PREQDALLTRLEEAKTGNQILDVLESCDG-LQSSHVVMGISLLWNIYHDAEQASKDAITDRV--- 129
            |...::|:|::::.....|:.|::|:... |....|....::||..........|:  .|.|   
Mouse    19 PFSCESLITQMQKCTNEEQVFDLIETNTATLSEQQVGCAFNVLWQFQKQKTVLEKN--VDHVRNH 81

  Fly   130 -----LLNVLPKLAPYVHQLEIDDLSRCYLY-LRKMHIPNSEAVVEAVLTRSLQLIESQVDDEVI 188
                 |.::.....|.:....:.|:    || :::..:.:...::||::|.:.:.:| :.|..| 
Mouse    82 PQFLTLCSITTNHIPAMSDATLVDV----LYSIKQFAVESHHPLIEALVTEAWKRLE-RFDTNV- 140

  Fly   189 PLTSLSRLSVGINLERDFFTPLVCRNFIPHLEHHIN-WCRSAEQVRLLSTCLFQLHFLIDEELFT 252
                ||..|..:..:..:|:||:.:     :...:| ...:.:.:|.||..:..:..||......
Mouse   141 ----LSIFSTCLADQHLYFSPLMGK-----IADIVNRRLETIQDLRALSVLMVSISSLISPCFQE 196

  Fly   253 RFKLRLTEMMQSGVLSSETPKALLKVIHMLNIPVWSQTHTQLIREVMLVLRPCIHQMESADLKSI 317
            |..:| ||::...|.||:...|...::.:.|:   ..:|..|:.....|.   |..|...||:||
Mouse   197 RLVIR-TELLFDTVNSSKVNIARRILLFLRNV---KYSHYPLLERCNQVF---IRNMSHLDLESI 254

  Fly   318 CRTFLHHQ----EPAALIEPLKKALEKLLQEEGTADA---LFCAVPFATPLQRDQYLHQFKE--L 373
            .:....:|    .....:|..:..|.::.......::   ||.|:   .|:.|.:...|.|.  |
Mouse   255 SKILNLYQFLQFHSFEFVEAARGRLAEMTLPSDHPESFVRLFAAL---GPVARPEIKKQLKSTIL 316

  Fly   374 LYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYWSGVVKELESCPEKHL----HLRFLRHCQ-- 432
            |.|||.     :|.....||.|::  |:|..|::   ::|::.|...|||    .:..|:..|  
Mouse   317 LLSEEL-----SSQQALIVLGAME--DMESRNSH---LLKKIVSVLYKHLDNYKSIELLKIIQAL 371

  Fly   433 RYMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAGRLPAKFARLASFVLAYGQTPLAWKKFPNF 497
            .:::|.:.        ||..||..:.::.:|   |..:|::.:.|.|        .|:....|:.
Mouse   372 TFLHFQSK--------ELFMKLRELLLSRLE---ASVIPSEISVLVS--------ALSMLPHPHL 417

  Fly   498 ---LLSKMLAMAPQLGIQD----CFLLSRGMQIASELRFRQHLPALAGMQLSTMDSI-LIGCAER 554
               .:|::.|:.||...::    ...|.|.:|  |:|   ..|.:..|.||..:..: .:|   |
Mouse   418 SETAVSRIEAVLPQCDFRELNDLVVYLMRWIQ--SDL---VCLASTTGKQLDLLQKLDQLG---R 474

  Fly   555 H-LRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQALAQYKNLHCNDLNSRVVRDMAYNFNAS 618
            | |:.:....|...||..:.....|...::.::.   ||.::    .::::...:..:|...:.:
Mouse   475 HRLQQSTNLDLLWEELKSLKGEWLHESLVEESIA---ALLRF----MDEIDYSNIAKVASFLSRT 532

  Fly   619 NFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRDFDQMSGLS 683
            |:....||:.:.:...:|        |||:...|.....:|.|:  ||:...    ..|:..| :
Mouse   533 NYLNTLLLDRIASVAIQQ--------VEKIHPFSVLAIILPFSI--LNYDPP----QKDEFFG-A 582

  Fly   684 VVQAC----------------LALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPERVL 732
            .||.|                .:|...:..||.|:.::|.::|:.|::.::::..|..:  .|:.
Mouse   583 CVQCCNSYLGTLDPGTLVFLGFSLAVLEYFPEDLLKKMFNIEFLARLDSQLEILPSSLS--ARIQ 645

  Fly   733 NLVMQLNRTVCLDFPEANVPWFQQNYIEAQISKKSLIPSESTTEVKQLLHQLLQNDKHFRCNHTT 797
            ..:|:|||.|||:.||..||||...:.:.|.:|.:.:.:.:..::.::|.::|...:..:.:..:
Mouse   646 FRLMELNRAVCLECPELQVPWFHDRFCQRQFNKDTGVMNGAQQQIYKMLAEVLGGHQCVKPSALS 710

  Fly   798 PYGYQIDFVIHFDRDKNPIP------AP----------PVEATMLDRITKVAILLLKLDSFCEND 846
            ||.:.:.|....|:.|.|:|      ||          .||..:.....::||.||.:.:||.| 
Mouse   711 PYYHTVGFECILDKRKKPLPYESHSIAPRKSLGMHWDSRVEPRLPPEAERIAIELLDVRAFCSN- 774

  Fly   847 LTALRGPESLKMRHLEMMGYKVMQINEHDWNSKYMASSTAKANYLK 892
            :..|:|..::|.||||::||:|:||...:|||..|::..|:.:||:
Mouse   775 IPHLKGKSAMKKRHLEILGYRVIQIPYFEWNSMAMSTKDARMDYLR 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 17/82 (21%)
FAST_2 736..816 CDD:285557 23/80 (29%)
RAP 834..894 CDD:214932 25/60 (42%)
Fastkd1NP_796218.2 FAST_1 560..628 CDD:284217 15/75 (20%)
FAST_2 648..729 CDD:285557 23/81 (28%)
RAP 763..821 CDD:214932 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53992093
eggNOG 1 0.900 E1_28HV5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4591
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006262
OrthoInspector 1 1.000 T1083546
orthoMCL 1 0.900 OOG5_139045
Panther 1 1.100 O PTHR21228
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.