DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and Fastkd2

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:XP_006245112.2 Gene:Fastkd2 RGDID:1307883 Length:689 Species:Rattus norvegicus

Alignment Length:627 Identity:121/628 (19%)
Similarity:228/628 (36%) Gaps:172/628 (27%)


  Fly   281 MLNIPVWSQTHTQLIREVMLVLRPCIHQMESADLKSICRTFLHHQEPAALIEPLKKALEKLLQE- 344
            |.:.|.::|...|::||..::...  |.:.|  |.:|.:  |...:.:.:::.|.:.:::.:.| 
  Rat   193 MFSHPAFNQLCEQMMREAKIMRYD--HLLFS--LNAIVK--LGVPQNSLMVQTLLRTIQERISEC 251

  Fly   345 -EGTADALFCAVPFATPLQRDQYLHQFKELLYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYW 408
             |.....|..|:....|......|.....:|..::.|                .::||....|..
  Rat   252 DERCLSILSTALVTMEPCMNVNALRAGLRILVDQQVW----------------NINDIFTLQTVM 300

  Fly   409 SGVVKELESCPEKHLHLRFLRHCQRYMNFNNNLGGTYRHL-ELERKLSRMCMNAIEHDIAGRLPA 472
            ..:.|:.....:|.|.::.|:...|:...|:      ||: |:        :.|::|        
  Rat   301 RCIGKDAPFALKKKLEMKALKELGRFSVLNS------RHMFEV--------LAAMDH-------- 343

  Fly   473 KFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGIQDCFLLSRGMQIASELRFRQHLPALA 537
                 .|.||                            :.:|..:.              :..:.
  Rat   344 -----RSVVL----------------------------LNECSKIV--------------IDNIH 361

  Fly   538 GMQLSTMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQALAQYKNLHCND 602
            |.....:.|||..|  |.||...:|...:  ::..|.|.....|||:.:.:              
  Rat   362 GCPFKVLISILQSC--RDLRYQNEDLFKS--IADYVATTFDIWKLKHVIFF-------------- 408

  Fly   603 LNSRVVRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNH 667
                     ..:|....|..|.|::.:...:.::...::...:..||..          ..:|||
  Rat   409 ---------LLSFETLGFRPPGLMDKLLEKVVQEPGSLTVKNIVSVLHV----------YSSLNH 454

  Fly   668 ASEVLLRDFDQMSGLSVVQACLALCFYKSIPEQLINQV--FCV-------KFIQRIEDEI--QVC 721
            ...|..|:|     |..:.:.|..|.::...|.|:|.|  ||:       ...|.|::.|  ::.
  Rat   455 VHNVQNREF-----LEALASALTGCLHQISSESLLNAVHSFCMMNYFPLAPINQLIKENIIHELL 514

  Fly   722 YS----KATYPERVLNLVMQLNRTV--CLDFPEANVPWFQQNYIEAQISKKSLIPSESTTEVKQL 780
            .|    |..:...|||..::|:.:.  |:..|...:|               |..|....::.::
  Rat   515 TSGDTEKNIHKLHVLNTCLKLDESTYKCIHIPLPQLP---------------LTASHPNEKLAEV 564

  Fly   781 LHQLLQNDKHFRCNHTTPYGYQIDFVIHFDRDKNPI-PAPPVEATMLDRITKVAILLLKLDSFCE 844
            |.:||:.|..|..|...|:.|.|||.|..|.::..: .....:|:....:.:||:|.:...::|.
  Rat   565 LSRLLEGDGCFSRNVQLPHNYHIDFEIRMDTNRTQVFSFSEGDASSATNMQRVAVLCVPKSAYCL 629

  Fly   845 NDLTALRGPESLKMRHLEMMGYKVMQINEHDWNSKYMASSTA 886
            |. ..|||..::|:|||.:||:.|:.|  |:|..|.:....|
  Rat   630 NS-NHLRGLMAMKIRHLNVMGFHVILI--HNWELKKLKMEDA 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 18/75 (24%)
FAST_2 736..816 CDD:285557 19/82 (23%)
RAP 834..894 CDD:214932 18/54 (33%)
Fastkd2XP_006245112.2 Med5 <366..>526 CDD:285852 39/202 (19%)
FAST_1 443..512 CDD:284217 20/84 (24%)
FAST_2 <561..596 CDD:285557 13/35 (37%)
RAP 619..675 CDD:214932 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21228
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.