DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31643 and FASTKD2

Sequence 1:NP_001285652.1 Gene:CG31643 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001129665.1 Gene:FASTKD2 HGNCID:29160 Length:710 Species:Homo sapiens

Alignment Length:863 Identity:169/864 (20%)
Similarity:295/864 (34%) Gaps:282/864 (33%)


  Fly    95 CDGLQSSHVVMGISLLWNI---YHDAEQAS-------KDAITDRVLLNVLPKLAPYVHQLEIDDL 149
            |.||....:|..   .|||   :|:..|::       :||...:..:....|....:..|.|:.|
Human    45 CLGLCKPKIVHS---NWNILNNFHNRMQSTDIIRYLFQDAFIFKSDVGFQTKGISTLTALRIERL 106

  Fly   150 SRCYLYLRKMHIPNSEAVVEAVLTRSLQLIESQVDDEVIPLTSLSRLSVGINLE---RDFFTPLV 211
                ||.:::...:.:::|..          .:.|||:        ..|.:|.|   .|..|...
Human   107 ----LYAKRLFFDSKQSLVPV----------DKSDDEL--------KKVNLNHEVSNEDVLTKET 149

  Fly   212 CRNFIPHLEHHINWCRSAEQVRLLSTCL--------------FQLHFLIDEELF---TRFKLRL- 258
            ..|       .|:..:.:|:...||..|              |...:.|.:.|.   .||:.|| 
Human   150 KPN-------RISSRKLSEECNSLSDVLDAFSKAPTFPSSNYFTAMWTIAKRLSDDQKRFEKRLM 207

  Fly   259 ----------TEMMQSGVLSSETPKALLKVIH---MLNIPVWSQTHTQLIREVMLVLRPCIHQME 310
                      ..||:...:...  |.||..:|   .|.||    .:|.|::.::.|.:..|::.:
Human   208 FSHPAFNQLCEHMMREAKIMQY--KYLLFSLHAIVKLGIP----QNTILVQTLLRVTQERINECD 266

  Fly   311 SADLKSICRTFLHHQEPAALIEPLKKALEKLLQEE-------GTADALFCAVPFATP--LQRDQY 366
            ...| |:..|.|...||...:..|:.....|:.::       .|...:...:....|  |:|...
Human   267 EICL-SVLSTVLEAMEPCKNVHVLRTGFRILVDQQVWKIEDVFTLQVVMKCIGKDAPIALKRKLE 330

  Fly   367 LHQFKELLYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYWSGVVKELESCPEKHLHLRFLRHC 431
            :...:||    :.:...| |.|:|.||.|:....:...:.....|:..:..||.: :.:..|:.|
Human   331 MKALREL----DRFSVLN-SQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLR-IMINILQSC 389

  Fly   432 QRYMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAGRLPAKFARLASFVLAYGQTPLAWKKFPN 496
            :...         |.:|:|                       |..||.:|.|   |...| ||..
Human   390 KDLQ---------YHNLDL-----------------------FKGLADYVAA---TFDIW-KFRK 418

  Fly   497 FL----LSKMLAMAPQLGIQDCFLLSRGMQIASELRFRQHLPALAGMQLSTMDSILIGCAERHLR 557
            .|    |.:.|...| :|:.|.|:                                    :|.:.
Human   419 VLFILILFENLGFRP-VGLMDLFM------------------------------------KRIVE 446

  Fly   558 DAEKDPLNASELSMIVRT---LSHRKKLKNTVVYNQALAQYKNLHCNDLNSRVVRDMAYNFNASN 619
            |.|.  ||...:..|:.|   |:|..|.:|...:.:.:|.....:.:.::|..:.|..|:|...|
Human   447 DPES--LNMKNILSILHTYSSLNHVYKCQNKEQFVEVMASALTGYLHTISSENLLDAVYSFCLMN 509

  Fly   620 FF--VP--ELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRDFDQMS 680
            :|  .|  :||:.              |.:.::||..                      |.....
Human   510 YFPLAPFNQLLQK--------------DIISELLTSD----------------------DMKNAY 538

  Fly   681 GLSVVQACLALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPERVLNLVMQLNRTVCLD 745
            .|..:..||                       :::|.:.:                   |.:.|.
Human   539 KLHTLDTCL-----------------------KLDDTVYL-------------------RDIALS 561

  Fly   746 FPEANVPWFQQNYIEAQISKKSLIPSESTTEVKQLLHQLLQNDKHFRCNHTTPYGYQIDFVIHFD 810
            .|:  :|             :.|..|.:..:|.::|..||..:.||..:...|:.|.|||.|..|
Human   562 LPQ--LP-------------RELPSSHTNAKVAEVLSSLLGGEGHFSKDVHLPHNYHIDFEIRMD 611

  Fly   811 RDKNPI-PAPPVEATMLDRITKVAILLLKLDSFCENDLTALRGPESLKMRHLEMMGYKVMQINEH 874
            .::|.: |...|:.|....|.:||:|.:...::|... :..||..::|||||..||:.|:.:|  
Human   612 TNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGS-SHPRGFLAMKMRHLNAMGFHVILVN-- 673

  Fly   875 DWNSKYMASSTAKANYLK 892
            :|....:....| ..:||
Human   674 NWEMDKLEMEDA-VTFLK 690

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 6/66 (9%)
FAST_2 736..816 CDD:285557 20/80 (25%)
RAP 834..894 CDD:214932 17/60 (28%)
FASTKD2NP_001129665.1 FAST_1 457..527 CDD:310980 17/84 (20%)
FAST_2 <572..618 CDD:312018 15/46 (33%)
RAP 636..692 CDD:214932 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.