DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and SEC14L5

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 HGNCID:29032 Length:696 Species:Homo sapiens

Alignment Length:295 Identity:50/296 (17%)
Similarity:98/296 (33%) Gaps:64/296 (22%)


  Fly    11 LQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYT 75
            :||.|:.:              ||.| |::.|......|:.:|.|||...|.|::|:|...:..:
Human   241 MQESCLIQ--------------LRHW-LQETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLS 290

  Fly    76 ----------LQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSK 130
                      ||...|....|...|......||               .|..:.|:|.|..||. 
Human   291 WRKQHQVDLLLQTWQPPALLEEFYAGGWHYQDI---------------DGRPLYILRLGQMDTK- 339

  Fly   131 HKFQDIIRVGSMFGEIMMFEDD------------NATVSGYVEIMDMAGVTGSHLFALQPQLLSK 183
             .....:...::...::...::            ...:|.:..::|:.|:...||:....:.|.:
Human   340 -GLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLR 403

  Fly   184 FSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSS-----DPAAIYELVRRK 243
            .....::..|.....:..:..|..|...:..:..|.....:.:..:.|     .|..:.:.:.|:
Human   404 MIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDRE 468

  Fly   244 YLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQ 278
            .:|...||     :.:.:..|..|.....|..|.:
Human   469 VIPDFLGG-----ESVCNVPEGGLVPKSLYMTEEE 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/45 (31%)
SEC14 96..252 CDD:238099 24/173 (14%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
CRAL_TRIO_N 243..288 CDD:215024 16/60 (27%)
SEC14 306..479 CDD:214706 27/195 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.