DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and CG11550

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster

Alignment Length:297 Identity:80/298 (27%)
Similarity:134/298 (45%) Gaps:32/298 (11%)


  Fly    31 EALR--DWVLKQPHLRACTDDQF----LLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVF----N 85
            |.|:  ||:..|||:    .|:|    .|.|....::|:|.||:..|...|.:..:.|.|    .
  Fly    20 EVLKFLDWIHAQPHI----SDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDC 80

  Fly    86 ERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFE 150
            ||     |::...:|...::.:| .|...|.||.:.:....:||.:.|.|::::..|..:..|:|
  Fly    81 ER-----PEIRRAMRTVSIVPLP-GATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYE 139

  Fly   151 DDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSL 215
            |  ....|:|.::|:...:..|:..:....:.||..|..||...|..|.||||:....:.....:
  Fly   140 D--GIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALM 202

  Fly   216 RSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQNF 280
            ..|...::.:.:.:.||....|:.|.::.||:||   ||.|::.:...|..........:|...|
  Fly   203 TPFMKKELTTVLHMHSDLKEFYKFVPQEMLPKEY---GGQLEEANVAKEIYYKKLLDNRKEMIEF 264

  Fly   281 ----GANDKLREFGDHKRGNHRSSFGAVGSFRKLEID 313
                ..|:|||   ..|..|....||..|:|:||:||
  Fly   265 ETRHQVNEKLR---PGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 16/47 (34%)
SEC14 96..252 CDD:238099 38/156 (24%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 39/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10174
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.