DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and CG30339

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster

Alignment Length:313 Identity:134/314 (43%)
Similarity:191/314 (61%) Gaps:5/314 (2%)


  Fly     1 MSSVRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLER 65
            |:::|||:|.|:.|...||||:..|:..|::|||||:.|||||||..|||||:.||||.|||||:
  Fly     1 MANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEK 65

  Fly    66 AKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSK 130
            .|.|.|.|||::..:||:|.:|  ..|.:.|.:.|.|..:::|......|||:.:.....:|..:
  Fly    66 TKSKLDHFYTIKTLMPELFGKR--LVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKE 128

  Fly   131 HKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTR 195
            .|..|:.|..:|..|..:.|||::.:||||||:|||.::.|.|..|...|:.:...:|::|.|||
  Fly   129 FKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTR 193

  Fly   196 QKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDIS 260
            .||:|.||.|.......|..:|..|:|::.|..|..:...:.|::.|:|||:||||..|.:.||.
  Fly   194 LKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQ 258

  Fly   261 HTMEAKLSSYGPYFRESQNFGANDKLREFGDHKRGNHRSSFGAVGSFRKLEID 313
            ...|.||.||..||.|...:|.:::||   ..||.|..|.|||.||||||:||
  Fly   259 AEAEKKLLSYESYFAEDSQYGVDEQLR---PGKRVNADSIFGAEGSFRKLDID 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 30/45 (67%)
SEC14 96..252 CDD:238099 55/156 (35%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 29/42 (69%)
CRAL_TRIO 109..250 CDD:279044 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4487195
eggNOG 1 0.900 E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10174
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.