DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and R03A10.5

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans

Alignment Length:303 Identity:58/304 (19%)
Similarity:102/304 (34%) Gaps:97/304 (32%)


  Fly    20 NELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRG------------TKFSLE-RAKEKFD 71
            |::.....:.|:.||: ::|.........|..:|.:|:|            .||.|. ||....|
 Worm     6 NDIQPYDLKKIQQLRE-LVKDDISEYYNTDFNILRWLQGHNTLPIEEIARKMKFHLNLRAAWNLD 69

  Fly    72 RFYTLQRSIPEVFNERRLATDPQ------VLDIVRMGVLLQIPMDADDPGPRVT-----IIRAGS 125
            ..:..:|:.|...:.:...|.|.      :::|.:.|       ..|..|...|     ::||..
 Worm    70 ELHKKERNHPIHKHWKYGITGPSGHMDNVIVNIEQCG-------KTDYTGMMETYSILEVMRARM 127

  Fly   126 YDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAG----------VTGSHLFALQPQL 180
            .|..:           |...:|..|......:..:.:||:.|          ||||        :
 Worm   128 VDLEQ-----------MLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTGS--------M 173

  Fly   181 LSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYL 245
            .|.....||          |::.:          ::.|.|      :.|.|...|:|.:| |..|
 Worm   174 KSLADFMAD----------HYVEM----------IKYFVP------VCVPSFATALYVVV-RPLL 211

  Fly   246 PQE-------YGGTGGNLQDISHTMEAKLSSYGPYFRESQNFG 281
            |::       .|.|......:.:.:.:.|.|.  :..|:..||
 Worm   212 PEKTREKVRLIGETNWRDDVLQYAIHSSLPSI--WNNENHTFG 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/58 (24%)
SEC14 96..252 CDD:238099 33/178 (19%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 40/227 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.