DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and C34C12.6

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans

Alignment Length:338 Identity:62/339 (18%)
Similarity:121/339 (36%) Gaps:88/339 (26%)


  Fly     2 SSVRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERA 66
            |.:..:.|.|||       :||..:..|:..                |..|..::||.....|:.
 Worm    19 SQINSVRAMLQE-------KLPDGIPDDVNT----------------DLNLCRWIRGYHGDTEKL 60

  Fly    67 KEKFDRFYTLQRSIPEVFNE--RRLATDPQVLDIVRM--GVLLQIPMDADDPGPRVTIIRAGS-- 125
            .:.|..:...:::...|.|:  .:....|.:...::.  ...||....:|:....:.:.||.|  
 Worm    61 VKNFATYLASRKAAGFVGNDFAEKFFELPSIAPFLQFIASSRLQDRQWSDEHNAFLFVERAWSQP 125

  Fly   126 ------YDTS-------------------KHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDM 165
                  :.||                   :.|.|...:....|  |::|:.:...::.||.  .|
 Worm   126 KEFIKTFKTSDYLLHCFGYSEMLQQLILRREKKQSADKGPVQF--IVIFDLNTVNITDYVN--PM 186

  Fly   166 AGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVS 230
            :|.  ..|:.::.:|...:       .|...:.|:..|.|......:...|.|...:...||.:.
 Worm   187 SGY--MKLWQIRSELWQDW-------FPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEII 242

  Fly   231 SDPAAIYELVRRKYL-----PQEYGGTGGNL----QDISHTMEAKLSSYGPYFRESQNFGANDKL 286
            ||.:.:    ..|:|     |:||||...|.    .:...::..|::| ..|::..|::      
 Worm   243 SDKSDL----AGKFLPPWLVPKEYGGEFVNTVPPGDETGVSVRRKITS-ADYYKPYQHY------ 296

  Fly   287 REFG-DHKRGNHR 298
            :|.| |..:.:|:
 Worm   297 KEHGIDRPKSSHK 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 7/45 (16%)
SEC14 96..252 CDD:238099 36/190 (19%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 36/191 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.