DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31636 and sec14l1

Sequence 1:NP_001285685.1 Gene:CG31636 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_012825399.1 Gene:sec14l1 XenbaseID:XB-GENE-5823346 Length:717 Species:Xenopus tropicalis

Alignment Length:313 Identity:63/314 (20%)
Similarity:108/314 (34%) Gaps:64/314 (20%)


  Fly    17 RELNELPARMAQDIEALRDWVLKQPHL----------RACTDDQFLLAFLRGTKFSLERAKEKFD 71
            |.|.:|.......:..||.| |::.|.          .....|:.:|.|||...|::|:|:|...
 Frog   242 RYLGQLTPMQESALIHLRQW-LQETHKGKSEAGEWKPEKIPKDEHILRFLRARDFNMEKAREMLC 305

  Fly    72 RF----------YTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSY 126
            :.          |.||...|           |:||:....|....    .|..|..:.|:|.|..
 Frog   306 QSLSWRKQHQVDYILQTWQP-----------PRVLEEYYAGGWHY----HDKDGRPLYILRLGQV 355

  Fly   127 DTS---KHKFQDII--RVGSMFGEIMMFEDDNATVSG-----YVEIMDMAGVTGSHLFALQPQLL 181
            ||.   |...::.|  .|.|:..|.....::|....|     :..::|:.|:...||:....:.|
 Frog   356 DTKGLVKALGEEAILRHVLSINEEGQKRCEENTRQFGRPIWSWTCLVDLEGLNMRHLWRPGVKAL 420

  Fly   182 SKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSS-----DPAAIYELVR 241
            .:.....:...|.....:..:..|..|...:..:..|.....:.:..:.|     .|..|.:.|.
 Frog   421 LRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPFINENSRQKFLIYSGNNYQGPGGIADYVD 485

  Fly   242 RKYLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQNFGANDKLREFGDHKR 294
            ::.:|...||     :.:.:..|..|.....|        .:|:..|..||.|
 Frog   486 KEIVPDFLGG-----ECVCNIPEGGLVPKSLY--------QSDEDAEMSDHIR 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/55 (25%)
SEC14 96..252 CDD:238099 32/171 (19%)
sec14l1XP_012825399.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 252..307 CDD:215024 14/56 (25%)
CRAL_TRIO 332..496 CDD:279044 31/173 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.