DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and HAP5

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_015003.1 Gene:HAP5 / 854540 SGDID:S000005885 Length:242 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:20/94 - (21%)
Similarity:38/94 - (40%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAAR 71
            |.:.:...||.|      .|..||.::::.....:.:.|.||:..|...|....|:...|...|.
Yeast   148 GSEHQDDFKSHS------LPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITELTMRAWCVAE 206

  Fly    72 DNKKTRIIPRHLQLAIRNDEELNKLLSGV 100
            .||:..:....:..|::..:..:.|:..|
Yeast   207 RNKRRTLQKADIAEALQKSDMFDFLIDVV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 18/85 (21%)
HAP5NP_015003.1 HAP5 1..>242 CDD:227533 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.