DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and HTA4

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190717.1 Gene:HTA4 / 826990 AraportID:AT4G13570 Length:124 Species:Arabidopsis thaliana


Alignment Length:95 Identity:47/95 - (49%)
Similarity:63/95 - (66%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SNRAGLQFPVGRIHRLLRKGNYA-ERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR 81
            :|...::|.|.|||:.|:....| ..|||...||:.:::|||..|||:||.|.::|.|..||.||
plant    30 TNYKCIRFQVARIHKQLKNRVSAHSSVGATDVVYMTSILEYLTTEVLQLAENTSKDLKVKRITPR 94

  Fly    82 HLQLAIRNDEELNKLLSGVTIAQGGVLPNI 111
            |||||||.||||:.|:.| ||..|.|:|:|
plant    95 HLQLAIRGDEELDTLIKG-TIIGGSVIPHI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 47/95 (49%)
HTA4NP_001190717.1 H2A 35..124 CDD:305064 46/90 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.