DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and His2A:CG33862

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001027381.1 Gene:His2A:CG33862 / 3772278 FlyBaseID:FBgn0053862 Length:124 Species:Drosophila melanogaster


Alignment Length:124 Identity:124/124 - (100%)
Similarity:124/124 - (100%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 107/107 (100%)
His2A:CG33862NP_001027381.1 PTZ00017 16..124 CDD:185399 107/107 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Homologene 1 1.000 - - H134465
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.