DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and NC2alpha

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:47/97 - (48%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL--ELAGNAARDNKKTRI 78
            |:..:...:||.|||.::::......:|....||.::..:|.....:|  .|....|| |.|| :
  Fly     3 SKKKKYNARFPAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNAR-NAKT-L 65

  Fly    79 IPRHLQLAIRND------EELNKLLSGVTIAQ 104
            .|.|::..|.::      :||.:.:..:::|:
  Fly    66 SPSHMRQCIVSEKRFDFLKELVRNIPDISVAE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 23/97 (24%)
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.