DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and pht1

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_595630.3 Gene:pht1 / 2539668 PomBaseID:SPBC11B10.10c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:78/132 - (59%)
Similarity:88/132 - (66%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSR---------SNRAGLQFPVGRIHRLLR-KGNYAERVGAGAPVYLAAVM 55
            |||.|||..|.||..|:         |.||||||||||:.|.|: |.....||||.:.||.|||:
pombe     1 MSGGGKGKHVGGKGGSKIGERGQMSHSARAGLQFPVGRVRRFLKAKTQNNMRVGAKSAVYSAAVL 65

  Fly    56 EYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            |||.|||||||||||:|.|..||.|||||||||.||||:.|:. .|||.|||||:|...||.:..
pombe    66 EYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDTLIR-ATIAGGGVLPHINKQLLIRTK 129

  Fly   121 EK 122
            ||
pombe   130 EK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 69/117 (59%)
pht1NP_595630.3 HTA1 18..139 CDD:227587 68/115 (59%)
H2A 25..127 CDD:238029 66/102 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.